Rabbit Polyclonal Anti-NKRF Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKRF antibody: synthetic peptide directed towards the middle region of human NKRF. Synthetic peptide located within the following region: QKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN |
Rabbit Polyclonal Anti-NKRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKRF antibody: synthetic peptide directed towards the N terminal of human NKRF. Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK |
NKRF (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human NKRF |
Rabbit Polyclonal Anti-NKRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKRF antibody: synthetic peptide directed towards the N terminal of human NKRF. Synthetic peptide located within the following region: HFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDG |
Rabbit Polyclonal Anti-NKRF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKRF antibody: synthetic peptide directed towards the N terminal of human NKRF. Synthetic peptide located within the following region: TCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNE |
Carrier-free (BSA/glycerol-free) NKRF mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
NKRF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 391-690 of human NKRF (NP_060014.2). |
| Modifications | Unmodified |
NKRF mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
NKRF mouse monoclonal antibody, clone OTI4C2 (formerly 4C2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
NKRF mouse monoclonal antibody, clone OTI4C2 (formerly 4C2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
NKRF mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
