Antibodies

Jump to Filters
View as table Download
Neuronatin (NNAT) Rabbit Polyclonal Antibody
TA339008

USD 375.00

5 Days

Rabbit Polyclonal Anti-NNAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NNAT antibody: synthetic peptide directed towards the middle region of human NNAT. Synthetic peptide located within the following region: MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ
Neuronatin (NNAT) Rabbit Polyclonal Antibody
TA359173

USD 360.00

5 Days

NNAT Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human NNAT