Neuronatin (NNAT) Rabbit Polyclonal Antibody

CAT#: TA339008

Rabbit Polyclonal Anti-NNAT Antibody

Product Images

WB Suggested Anti-NNAT Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NNAT antibody: synthetic peptide directed towards the middle region of human NNAT. Synthetic peptide located within the following region: MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 6
• Gene Name: neuronatin
• Database Link:
  NP_859017
  Entrez Gene 4826 Human
  UniProt ID Q16517
• Background: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]
• Synonyms: Peg5
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane