Rabbit Polyclonal Anti-NPAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the C terminal of human NPAS1. Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD |
Rabbit Polyclonal Anti-NPAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the middle region of human NPAS1. Synthetic peptide located within the following region: SSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTLTKRGLHVKAS |
Rabbit Polyclonal Anti-Npas1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Npas1 antibody: synthetic peptide directed towards the middle region of mouse Npas1. Synthetic peptide located within the following region: LPAIVSQEEPSRPGPEPTEEEPPVDGKQAVPADQDKDKDPQARGKRIKVE |
Carrier-free (BSA/glycerol-free) NPAS1 mouse monoclonal antibody,clone OTI4F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPAS1 mouse monoclonal antibody,clone OTI1H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPAS1 mouse monoclonal antibody,clone OTI3H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPAS1 mouse monoclonal antibody, clone OTI5B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NPAS1 mouse monoclonal antibody,clone OTI4F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI4F3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI4F3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NPAS1 mouse monoclonal antibody,clone OTI4F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NPAS1 mouse monoclonal antibody,clone OTI1H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI1H5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI1H5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NPAS1 mouse monoclonal antibody,clone OTI1H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NPAS1 mouse monoclonal antibody,clone OTI3H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI3H3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI3H3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NPAS1 mouse monoclonal antibody,clone OTI3H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI5B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI5B2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NPAS1 mouse monoclonal antibody,clone OTI5B2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NPAS1 mouse monoclonal antibody,clone OTI5B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
