PASD5 (NPAS1) Rabbit Polyclonal Antibody

CAT#: TA331127

Rabbit Polyclonal Anti-NPAS1 Antibody

Product Images

WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the middle region of human NPAS1. Synthetic peptide located within the following region: SSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTLTKRGLHVKAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: neuronal PAS domain protein 1
• Database Link:
  NP_002508
  Entrez Gene 4861 Human
  UniProt ID Q99742
• Background: NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
• Synonyms: bHLHe11; MOP5; PASD5
• Note: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors