Antibodies

Jump to Filters
View as table Download
NPB Rabbit Polyclonal Antibody
TA343302

USD 375.00

5 Days

Rabbit Polyclonal Anti-NPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPB antibody is: synthetic peptide directed towards the C-terminal region of NPB. Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV
NPB Rabbit Polyclonal Antibody
TA379247

USD 220.00

3 Weeks

NPB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human NPB (NP_683694.1).
Modifications Unmodified