NPB Rabbit Polyclonal Antibody

CAT#: TA343302

Rabbit Polyclonal Anti-NPB Antibody

Product Images

WB Suggested Anti-NPB Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPB antibody is: synthetic peptide directed towards the C-terminal region of NPB. Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: neuropeptide B
• Database Link:
  NP_683694
  Entrez Gene 256933 Human
  UniProt ID Q8NG41
• Background: Neuropeptide B (NPB) is an endogenous peptide ligand for G protein-coupled receptor-7.
• Synonyms: L7; PPL7; PPNPB
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane