Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2E1 Antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: RTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the middle region of human NR2E1. Synthetic peptide located within the following region: LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL |
Rabbit Polyclonal Anti-NR2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E1 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E1. Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR |
NR2E1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR2E1 |
NR2E1/TLX Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 106-385 of human NR2E1/TLX (NP_003260.1). |
| Modifications | Unmodified |
NR2E1/TLX Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 106-385 of human NR2E1/TLX (NP_003260.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
