NR2E1 Rabbit Polyclonal Antibody

CAT#: TA334016

Rabbit Polyclonal Anti-NR2E1 Antibody

Product Images

WB Suggested Anti-NR2E1 Antibody Titration: 0.03 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: NR2E1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NR2E1 Antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: RTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: nuclear receptor subfamily 2 group E member 1
• Database Link:
  NP_003260
  Entrez Gene 7101 Human
  UniProt ID Q9Y466
• Background: The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.
• Synonyms: TLL; TLX; XTLL
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors