Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NRIP2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NRIP2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-NRIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRIP2 antibody: synthetic peptide directed towards the N terminal of human NRIP2. Synthetic peptide located within the following region: HLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVIQRRLVEG |
Rabbit Polyclonal Anti-Nrip2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nrip2 antibody: synthetic peptide directed towards the N terminal of mouse Nrip2. Synthetic peptide located within the following region: MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLP |
Rabbit Polyclonal Anti-NRIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NRIP2 antibody: synthetic peptide directed towards the N terminal of mouse NRIP2. Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG |
NRIP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-281 of human NRIP2 (NP_113662.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NRIP2