NRIP2 Rabbit Polyclonal Antibody

CAT#: TA342347

Rabbit Polyclonal Anti-NRIP2 Antibody

Product Images

WB Suggested Anti-NRIP2 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Cerebellum

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NRIP2 antibody: synthetic peptide directed towards the N terminal of mouse NRIP2. Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: nuclear receptor interacting protein 2
• Database Link:
  NP_113662
  Entrez Gene 83714 Human
  UniProt ID Q9BQI9
• Background: NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors.
• Synonyms: DKFZp761G1913
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome