NRIP2 Rabbit Polyclonal Antibody
Other products for "NRIP2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NRIP2 antibody: synthetic peptide directed towards the N terminal of mouse NRIP2. Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | nuclear receptor interacting protein 2 |
Database Link | |
Background | NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors. |
Synonyms | DKFZp761G1913 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Zebrafish: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.