Rabbit Polyclonal Anti-ONECUT2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ONECUT2 antibody: synthetic peptide directed towards the middle region of human ONECUT2. Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI |
Rabbit Polyclonal Anti-ONECUT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ONECUT2 antibody: synthetic peptide directed towards the middle region of human ONECUT2. Synthetic peptide located within the following region: NGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRI |
Rabbit Polyclonal Anti-ONECUT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ONECUT2 Antibody: synthetic peptide directed towards the N terminal of human ONECUT2. Synthetic peptide located within the following region: TSMASILDGGDYRPELSIPLHHAMSMSCDSSPPGMGMSNTYTTLTPLQPL |
Germany
Japan
United Kingdom
China
