ONECUT2 Rabbit Polyclonal Antibody

CAT#: TA344540

Rabbit Polyclonal Anti-ONECUT2 Antibody - middle region

Product Images

WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: NCI-H226 cell lysateONECUT2 is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ONECUT2 antibody: synthetic peptide directed towards the middle region of human ONECUT2. Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: one cut homeobox 2
• Database Link:
  NP_004843
  Entrez Gene 9480 Human
  UniProt ID O95948
• Background: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT
• Synonyms: OC-2; OC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors