Rabbit Polyclonal Anti-OPN1MW Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-OPN1MW antibody is: synthetic peptide directed towards the C-terminal region of Human OPN1MW. Synthetic peptide located within the following region: SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG |
Rabbit Polyclonal Anti-OPN1MW Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-OPN1MW antibody: synthetic peptide directed towards the C terminal of human OPN1MW. Synthetic peptide located within the following region: SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS |
Opn1mw Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China