OPN1MW Rabbit Polyclonal Antibody

CAT#: TA342730

Rabbit Polyclonal Anti-OPN1MW Antibody

Product Images

WB Suggested Anti-OPN1MW Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OPN1MW antibody: synthetic peptide directed towards the C terminal of human OPN1MW. Synthetic peptide located within the following region: SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: opsin 1 (cone pigments), medium-wave-sensitive
• Database Link:
  NP_000504
  Entrez Gene 2652 Human
• Background: This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.
• Synonyms: CBBM; CBD; COD5; GCP; GOP; OPN1MW1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Pig: 91%; Zebrafish: 91%; Goat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane