Rabbit Polyclonal Anti-OSMR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the N terminal of human OSMR. Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ |
Rabbit Polyclonal Anti-OSMR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the middle region of human OSMR. Synthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
OSMR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China