OSMR Rabbit Polyclonal Antibody

CAT#: TA339390

Rabbit Polyclonal Anti-OSMR Antibody

Product Images

WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate.OSMR is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSMR antibody: synthetic peptide directed towards the N terminal of human OSMR. Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: oncostatin M receptor
• Database Link:
  NP_003990
  Entrez Gene 9180 Human
  UniProt ID Q99650
• Background: This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
• Synonyms: IL-31R-beta; IL-31RB; OSMRB; PLCA1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway