Antibodies

Jump to Filters
View as table Download
OTUD1 (Center) Rabbit Polyclonal Antibody
AP53131PU-N

USD 450.00

2 Weeks

OTUD1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 289-318 amino acids from the Central region of human OTUD1
OTUD1 Rabbit Polyclonal Antibody
TA332176

USD 375.00

5 Days

Rabbit Polyclonal Anti-OTUD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OTUD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OTUD1. Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN