OTUD1 Rabbit Polyclonal Antibody

CAT#: TA332176

Rabbit Polyclonal Anti-OTUD1 Antibody

Product Images

Host: Rabbit; Target Name: OTUD1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OTUD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OTUD1. Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: OTU deubiquitinase 1
• Database Link:
  NP_001138845
  Entrez Gene 220213 Human
  UniProt ID Q5VV17
• Background: Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA7 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
• Synonyms: DUBA7; OTDC1
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 86%