Antibodies

Jump to Filters
View as table Download
OAZ2 (C-term) Rabbit Polyclonal Antibody
AP52982PU-N

USD 450.00

2 Weeks

OAZ2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 128-155 amino acids from the C-terminal region of Human OAZ2
OAZ2 Rabbit Polyclonal Antibody
TA337673

USD 375.00

5 Days

Rabbit Polyclonal Anti-OAZ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OAZ2 antibody: synthetic peptide directed towards the middle region of human OAZ2. Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL