OAZ2 Rabbit Polyclonal Antibody

CAT#: TA337673

Rabbit Polyclonal Anti-OAZ2 Antibody

Product Images

WB Suggested Anti-OAZ2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OAZ2 antibody: synthetic peptide directed towards the middle region of human OAZ2. Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: ornithine decarboxylase antizyme 2
• Database Link:
  NP_002528
  Entrez Gene 4947 Human
  UniProt ID O95190
• Background: The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamine in cells. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis pathway; thus, completing the auto-regulatory circuit. This gene encodes antizyme 2, the second member of the antizyme family, and like antizyme 1, it has broad tissue distribution, and negatively regulates intracellular polyamine levels by binding to and targeting ODC for degradation in vivo, as well as by inhibiting polyamine uptake. Antizyme 2 is expressed at lower levels than antizyme 1, but is evolutionary more conserved, suggesting that it likely has an important biological role. Studies also show different subcellular localization of antizymes 1 and 2, indicating specific function for each antizyme in discrete compartments of the cell. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2014]
• Synonyms: AZ2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%