Antibodies

Jump to Filters
View as table Download
Odf1 Rabbit Polyclonal Antibody
TA335658

USD 375.00

5 Days

Rabbit Polyclonal Anti-Odf1 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Odf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
ODF1 Rabbit Polyclonal Antibody
TA379445

USD 220.00

3 Weeks

ODF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2).