Odf1 Rabbit Polyclonal Antibody

CAT#: TA335658

Rabbit Polyclonal Anti-Odf1 Antibody

Product Images

WB Suggested Anti-Odf1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Odf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: outer dense fiber of sperm tails 1
• Database Link:
  NP_032783
  Entrez Gene 18285 Mouse
• Background: Odf1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.
• Synonyms: HSPB10; MGC129928; MGC129929; ODF; ODF2; ODF27; ODFP; ODFPG; ODFPGA; ODFPGB; RT7; SODF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%