Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-OFLM4 antibody for SISCAPA, clone OTIR2A11
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Orangutan, Rat, Hamster, Dog, Rabbit (88%); Galago, Mouse, Panda, Horse (81%). |
OLFM4 Rabbit Polyclonal (aa400-450) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Human |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against a synthetic peptide corresponding to amino acids 400-419 (YVYNDGYLLNYDLSVLQKPQ) of human OLFM4 was used as immunogen for this antibody. Percent identity by BLAST analysis: Human, Gibbon (100%); Gorilla, Marmoset (95%); Monkey, Mouse, Rat (85%). |
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Galago, Marmoset (94%); Panda, Dog, Rabbit, Opossum (88%); Mouse, Rat, Horse (81%). |
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Dog, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 15 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Dog (100%); Gibbon, Monkey, Panda (93%); Marmoset, Bat (87%); Hamster, Rabbit, Pig (80%). |
Rabbit Polyclonal Anti-OLFM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLFM4 |
OLFM4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLFM4 |
OLFM4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- OLFM4