Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Optineurin Rabbit Polyclonal (aa575-591) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: SHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTEN |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OPTN Antibody: synthetic peptide directed towards the C terminal of human OPTN. Synthetic peptide located within the following region: SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII |
OPTN mouse monoclonal antibody,clone OTI7H2
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- OPTN