Germany
Japan
United Kingdom
China
Rabbit polyclonal Anti-P2X6 Receptor
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RTKYEEARAPKATTNSA, corresponding to amino acid residues 363-379 of rat P2X6 Receptor?. Intracellular, C-terminus. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-P2RXL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV |
Rabbit Polyclonal Anti-P2RXL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN |
P2RX6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-280 of human P2RX6 (NP_001153026.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- P2RX6