Rabbit Polyclonal Antibody against PARP6 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Parp6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 553-583 amino acids from the C-terminal region of human Parp6. |
Rabbit Polyclonal Antibody against PARP6 (C-term 503)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Parp6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 508-538 amino acids from the C-terminal region of human Parp6. |
Rabbit Polyclonal Anti-PARP6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the C terminal of human PARP6. Synthetic peptide located within the following region: KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW |
Rabbit Polyclonal Anti-PARP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the N terminal of human PARP6. Synthetic peptide located within the following region: HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK |
Rabbit Polyclonal Anti-PARP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the N terminal of human PARP6. Synthetic peptide located within the following region: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI |
Germany
Japan
United Kingdom
China
