PARP6 Rabbit Polyclonal Antibody

CAT#: TA334744

Rabbit Polyclonal Anti-PARP6 Antibody

Product Images

WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the C terminal of human PARP6. Synthetic peptide located within the following region: KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 6
• Database Link:
  NP_064599
  Entrez Gene 56965 Human
  UniProt ID Q2NL67
• Background: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
• Synonyms: ARTD17; PARP-6-B1; PARP-6-C; pART17
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%