Rabbit Polyclonal Anti-PBOV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PBOV1 antibody is: synthetic peptide directed towards the N-terminal region of Human PBOV1. Synthetic peptide located within the following region: RHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQ |
Rabbit Polyclonal Anti-PBOV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PBOV1 antibody is: synthetic peptide directed towards the N-terminal region of Human PBOV1. Synthetic peptide located within the following region: RAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYK |
Germany
Japan
United Kingdom
China
