PBOV1 Rabbit Polyclonal Antibody

CAT#: TA331280

Rabbit Polyclonal Anti-PBOV1 Antibody

Product Images

Host: Rabbit; Target Name: PBOV1; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; PBOV1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PBOV1 antibody is: synthetic peptide directed towards the N-terminal region of Human PBOV1. Synthetic peptide located within the following region: RHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: prostate and breast cancer overexpressed 1
• Database Link:
  NP_067648
  Entrez Gene 59351 Human
  UniProt ID Q9GZY1
• Background: This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer.
• Synonyms: dJ171N11.2; UC28; UROC28
• Note: Human: 100%