Antibodies

Jump to Filters
View as table Download
PCBD2 Rabbit Polyclonal Antibody
TA342966

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCBD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBD2 antibody: synthetic peptide directed towards the N terminal of human PCBD2. Synthetic peptide located within the following region: SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR
PCBD2 Rabbit Polyclonal Antibody
TA357696

USD 360.00

5 Days

PCBD2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated