PCBD2 Rabbit Polyclonal Antibody

CAT#: TA342966

Rabbit Polyclonal Anti-PCBD2 Antibody

Product Images

WB Suggested Anti-PCBD2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCBD2 antibody: synthetic peptide directed towards the N terminal of human PCBD2. Synthetic peptide located within the following region: SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: pterin-4 alpha-carbinolamine dehydratase 2
• Database Link:
  NP_115527
  Entrez Gene 84105 Human
  UniProt ID Q9H0N5
• Background: PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
• Synonyms: DCOH2; DCOHM; PHS2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Yeast: 90%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors