Rabbit Polyclonal Anti-PEX26 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX26 antibody: synthetic peptide directed towards the middle region of human PEX26. Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK |
Rabbit Polyclonal Anti-PEX26 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX26 antibody: synthetic peptide directed towards the N terminal of human PEX26. Synthetic peptide located within the following region: MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLD |
Goat Anti-PEX26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKPNLEGSVSHK, from the internal region of the protein sequence according to NP_060399.1. |
PEX26 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PEX26 |
Germany
Japan
United Kingdom
China
