PEX26 Rabbit Polyclonal Antibody

CAT#: TA344949

Rabbit Polyclonal Anti-PEX26 Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of peroxisomal biogenesis factor 26 (PEX26), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "PEX26"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PEX26 antibody: synthetic peptide directed towards the middle region of human PEX26. Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name peroxisomal biogenesis factor 26
Background This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero
Synonyms PBD7A; PBD7B; PEX26M1T; Pex26pM1T
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Bovine: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.