Antibodies

Jump to Filters
View as table Download
PEX5 related protein (PEX5L) Rabbit Polyclonal Antibody
TA345010

USD 475.00

5 Days

Rabbit Polyclonal Anti-PEX5L Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pex2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA
Pex5l Rabbit Polyclonal Antibody
TA329011

USD 585.00

3 Weeks

Rabbit polyclonal Anti-TRIP8b

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide(C)EKWDDVKFHGDRTSK, corresponding to amino acid residues 151-165 of rat TRIP8b.