PEX5 related protein (PEX5L) Rabbit Polyclonal Antibody

CAT#: TA345010

Rabbit Polyclonal Anti-PEX5L Antibody - C-terminal region

Product Images

WB Suggested Anti-Pex2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pex2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: peroxisomal biogenesis factor 5-like
• Database Link:
  NP_057643
  Entrez Gene 58869 Mouse
  UniProt ID Q8IYB4
• Background: The function remains unknown.
• Synonyms: PEX5R; PEX5RP; PXR2; PXR2B; TRIP8b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome