Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RNUXA / PHAX antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RNUXA. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PHAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHAX antibody is: synthetic peptide directed towards the C-terminal region of Human PHAX. Synthetic peptide located within the following region: DIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFA |
Rabbit Polyclonal Anti-PHAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHAX antibody is: synthetic peptide directed towards the middle region of Human PHAX. Synthetic peptide located within the following region: NYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRP |
PHAX Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PHAX |
PHAX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHAX |
Active filters
Target Symbol
- PHAX