PHAX Rabbit Polyclonal Antibody

CAT#: TA337956

Rabbit Polyclonal Anti-PHAX Antibody

Product Images

Host: Rabbit; Target Name: PHAX; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHAX antibody is: synthetic peptide directed towards the middle region of Human PHAX. Synthetic peptide located within the following region: NYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: phosphorylated adaptor for RNA export
• Database Link:
  NP_115553
  Entrez Gene 51808 Human
  UniProt ID Q9H814
• Background: PHAX is a phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. PHAX is also a bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other.
• Synonyms: RNUXA
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Pig: 83%; Rabbit: 79%; Rat: 77%; Mouse: 77%; Guinea pig: 75%