Rabbit Polyclonal Anti-PHF20L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF20L1 antibody: synthetic peptide directed towards the N terminal of human PHF20L1. Synthetic peptide located within the following region: AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE |
Carrier-free (BSA/glycerol-free) PHF20L1 mouse monoclonal antibody,clone OTI1H6
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PHF20L1 mouse monoclonal antibody,clone OTI1H6
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PHF20L1 mouse monoclonal antibody,clone OTI1H6, Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PHF20L1 mouse monoclonal antibody,clone OTI1H6, HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PHF20L1 mouse monoclonal antibody,clone OTI1H6
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
