PHF20L1 Rabbit Polyclonal Antibody

CAT#: TA339768

Rabbit Polyclonal Anti-PHF20L1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PHF20L1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PHF20L1 antibody: synthetic peptide directed towards the N terminal of human PHF20L1. Synthetic peptide located within the following region: AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 63 kDa
Gene Name PHD finger protein 20-like 1
Background The exact function of PHF20L1 remains unknown.
Synonyms CGI-72; TDRD20B
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%; Zebrafish: 82%; Mouse: 77%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.