Antibodies

Jump to Filters
View as table Download
PHOX2A Rabbit Polyclonal Antibody
TA319616

USD 430.00

5 Days

Rabbit Polyclonal PHOX2A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PHOX2A antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human PHOX2A.
PHOX2A Goat Polyclonal Antibody
TA311322

USD 375.00

5 Days

Goat Anti-PHOX2A (aa165-179) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KGEARCSSEDDDSKE, from the internal region of the protein sequence according to NP_005160.2.
PHOX2A Rabbit Polyclonal Antibody
TA329397

USD 375.00

5 Days

Rabbit Polyclonal anti-PHOX2A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: AVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTRE
PHOX2A Rabbit Polyclonal Antibody
TA329897

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHOX2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the N terminal of human PHOX2A. Synthetic peptide located within the following region: SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR
PHOX2A Rabbit Polyclonal Antibody
TA343509

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHOX2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the C terminal of human PHOX2A. Synthetic peptide located within the following region: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF