PHOX2A Rabbit Polyclonal Antibody

CAT#: TA343509

Rabbit Polyclonal Anti-PHOX2A Antibody

Product Images

WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHOX2A antibody: synthetic peptide directed towards the C terminal of human PHOX2A. Synthetic peptide located within the following region: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: paired like homeobox 2a
• Database Link:
  NP_005160
  Entrez Gene 401 Human
  UniProt ID O14813
• Background: PHOX2A contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. PHOX2A has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene.
• Synonyms: ARIX; CFEOM2; FEOM2; NCAM2; PMX2A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors