Antibodies

Jump to Filters
View as table Download
PHYHD1 (C-term) Rabbit Polyclonal Antibody
AP53292PU-N

USD 450.00

2 Weeks

PHYHD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 231-260aa) of human PHYHD1.
PHYHD1 Rabbit Polyclonal Antibody
TA331585

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHYHD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHYHD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human PHYHD1. Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL
PHYHD1 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF811367

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PHYHD1 mouse monoclonal antibody,clone OTI1A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PHYHD1 Rabbit Polyclonal Antibody
TA379902

USD 220.00

3 Weeks

PHYHD1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-291 of human PHYHD1 (NP_001094346.1).
Modifications Unmodified
PHYHD1 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA811367

USD 379.00

In Stock

PHYHD1 mouse monoclonal antibody,clone OTI1A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PHYHD1 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA811367S

USD 159.00

2 Days

PHYHD1 mouse monoclonal antibody,clone OTI1A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated