PHYHD1 Rabbit Polyclonal Antibody

CAT#: TA331585

Rabbit Polyclonal Anti-PHYHD1 Antibody

Product Images

Host: Rabbit; Target Name: PHYHD1; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PHYHD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human PHYHD1. Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: phytanoyl-CoA dioxygenase domain containing 1
• Database Link:
  NP_777593
  Entrez Gene 254295 Human
  UniProt ID Q5SRE7
• Background: Isoform 1 has alpha-ketoglutarate-dependent dioxygenase activity. PHYHD1 does not show detectable activity towards fatty acid CoA thioesters. PHYHD1 is not expected to be active with phytanoyl CoA. Isoform 2 and isoform 3 probably lack enzyme activity.
• Synonyms: MGC16638
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Dog: 86%; Horse: 86%; Guinea pig: 86%