Antibodies

Jump to Filters
View as table Download
PIP4K2C Rabbit Polyclonal Antibody
TA337983

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIP4K2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIP4K2C antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2C. Synthetic peptide located within the following region: LKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHD
PIP4K2C Rabbit Polyclonal Antibody
TA362205

USD 360.00

5 Days

PIP4K2C Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PIP4K2C