PIP4K2C Rabbit Polyclonal Antibody

CAT#: TA337983

Rabbit Polyclonal Anti-PIP4K2C Antibody

Product Images

WB Suggested Anti-PIP4K2C Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell PIP4K2C is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIP4K2C antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2C. Synthetic peptide located within the following region: LKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
• Database Link:
  NP_079055
  Entrez Gene 79837 Human
  UniProt ID Q8TBX8
• Background: PIP4K2C may play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.
• Synonyms: PIP5K2C
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton