Antibodies

View as table Download

Rabbit Polyclonal PEPP2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-PLEKHA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLEKHA5 Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHA5. Synthetic peptide located within the following region: ASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATE