PEPP2 (PLEKHA5) Rabbit Polyclonal Antibody

CAT#: TA331842

Rabbit Polyclonal Anti-PLEKHA5 Antibody

Product Images

Host: Rabbit; Target Name: PLEKHA5; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLEKHA5 Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHA5. Synthetic peptide located within the following region: ASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 146 kDa
• Gene Name: pleckstrin homology domain containing A5
• Database Link:
  NP_061885
  Entrez Gene 54477 Human
  UniProt ID Q9HAU0
• Background: The function of this protein remains unknown.
• Synonyms: PEPP-2; PEPP2
• Note: Immunogen sequence homology: Human: 100%; Mouse: 92%; Dog: 86%