Rabbit Polyclonal Anti-PLGLB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLGLB2 Antibody is: synthetic peptide directed towards the middle region of Human PLGLB2. Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR |
PLGLB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLGLB2 |
PLGLB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLGLB2 |
Germany
Japan
United Kingdom
China