PLGLB1 (PLGLB2) Rabbit Polyclonal Antibody

CAT#: TA332121

Rabbit Polyclonal Anti-PLGLB2 Antibody

Product Images

Host: Rabbit; Target Name: PLGLB2; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLGLB2 Antibody is: synthetic peptide directed towards the middle region of Human PLGLB2. Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: plasminogen-like B2
• Database Link:
  NP_002656
  Entrez Gene 5342 Human
  UniProt ID Q02325
• Background: The function of this protein remains unknown.
• Synonyms: PLGP1
• Note: Immunogen sequence homology: Human: 100%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Secreted Protein